| Product Name |
SARS-CoV-2 Spike Glycoprotein RBD (Recombinant) |
| Catalog Number |
EG-302 |
| Description |
Recombinant SARS-CoV-2 spike glycoprotein receptor-binding domain (RBD, Arg319–Phe541, Wuhan-Hu-1, GenBank: QHD43416.1) expressed in HEK293 cells, with a C-terminal hexa-histidine tag. Purified by nickel affinity and ion exchange chromatography.
|
| Mutations |
Wild-type (Wuhan-Hu-1 reference) |
| Tags |
C-terminal 6xHis |
| Purification |
FPLC (nickel affinity and ion exchange chromatography) |
| Sequence |
RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFGSHHHHHH
|
| Molecular Weight |
25.9 kDa (theoretical) |
| Source |
HEK293 cells |
| Purity |
≥90% by SDS-PAGE |
| Applications |
Western blot, ELISA, and animal immunization studies |
| Storage Buffer |
PBS with 50% glycerol |
| Storage |
-20°C to -80°C |
| Shipping |
Dry ice |